PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007319
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 358aa    MW: 38658.8 Da    PI: 8.9873
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007319genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822202.81.1e-6221461149
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaa..gssasaspesslq 95 
                  ++++r+ptwkErEnnkrRERrRRaiaakiy+GLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg++p  e+++++  g s+sasp+ss+q
  Lus10007319   2 TSGTRMPTWKERENNKRRERRRRAIAAKIYTGLRMYGNYKLPKHCDNNEVLKALCQEAGWIVEEDGTTYRKGCRPAlERMNIMggGGSTSASPCSSYQ 99 
                  5899*************************************************************************9998762257999******** PP

       DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                   s+ ss+++sp++s  +++++++   +       +a+a+sl+p+l++ls++sss
  Lus10007319 100 PSPASSSFPSPISSHYTTTNAVNNNNN-------AADANSLIPWLKNLSSSSSS 146
                  99********99999888888765443.......34557889999999886665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.2E-583141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI YTGLRMYGNY KLPKHCDNNE VLKALCQEAG  60
WIVEEDGTTY RKGCRPALER MNIMGGGGST SASPCSSYQP SPASSSFPSP ISSHYTTTNA  120
VNNNNNAADA NSLIPWLKNL SSSSSSASSS KHNHPHNLYI HTGSISAPVT PPLSSPTAQS  180
PRRKKQNDVW GDDHHHHPSA CPSWVGQNYP FLPSSSMPSS TPQSPSRHPD PSAWLPGMQS  240
GPTSPTFSLV ARNPFGSGAG SRMWTPGQSG TCSPAVFDHT ADVPMADSSM AAEFAFGSNS  300
SSAAARLVKP WEGERIHEEL ISDDLELTLG SSKTSGGDVV TERWNVDGWK KARMSSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352718.11e-132PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-104BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLB9S8F21e-126B9S8F2_RICCO; BRASSINAZOLE-RESISTANT 2 protein, putative
STRINGPOPTR_0004s06100.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26613375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.14e-75BES1/BZR1 homolog 4